PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_24525_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 313aa    MW: 36540.2 Da    PI: 9.8224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_24525_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.91.3e-09743136
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS- CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRt 36
                                         +g W +eEd++l ++v+ +G g W+t++++ g   R+
  cra_locus_24525_iso_1_len_938_ver_3  7 KGFWKPEEDLILRKYVEIHGEGKWRTVSEKSGnXERC 43
                                         688***************************9954444 PP

2Myb_DNA-binding51.13.2e-1696141148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg ++++E +l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  cra_locus_24525_iso_1_len_938_ver_3  96 RGEMSEQEKDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 141
                                          8999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.082255IPR017930Myb domain
SuperFamilySSF466894.02E-8243IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-19237IPR009057Homeodomain-like
SMARTSM007171.4E-6692IPR001005SANT/Myb domain
PfamPF002491.8E-6841IPR001005SANT/Myb domain
CDDcd001672.59E-41045No hitNo description
Gene3DG3DSA:1.10.10.601.6E-197393IPR009057Homeodomain-like
SuperFamilySSF466891.11E-1976149IPR009057Homeodomain-like
PROSITE profilePS5129424.36891145IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2294143IPR009057Homeodomain-like
SMARTSM007172.9E-1695143IPR001005SANT/Myb domain
PfamPF002491.0E-1496141IPR001005SANT/Myb domain
CDDcd001678.07E-1198141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
XKPKLKKGFW KPEEDLILRK YVEIHGEGKW RTVSEKSGNX ERCRRLMNCK MQDQIYTNKD  60
KRHLYMFLVV YCAGLKRGGR SCRLRWKNYL RPNIKRGEMS EQEKDLIIRL HKLLGNRWSL  120
IAGRLPGRTD NEVKNYWNTH LHKVVSGDKT KEQQQQQMVK SPKPQVPSSA TMAKTSPPDD  180
KETEKMNHQV RSLSLQDFAQ IFWDEGTFSL TTENILFHPF VGDDDFQSFL LLXNQSYSAC  240
PAATKCSDWE SSFSAQFRDA RNCSRLLLAY LFCSKCLLAV GQSRTSSIYT TLPITVIKFH  300
YESNIQPCRE TFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C6e-2051454159MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-2051454159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282342.14e-58PREDICTED: transcription factor MYB82
TrEMBLD7TC474e-58D7TC47_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g05660.t011e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154